Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 4,094

  1. Avatar for JasperD 82. JasperD Lv 1 3 pts. 8,605
  2. Avatar for tela 83. tela Lv 1 3 pts. 8,598
  3. Avatar for Phyx 84. Phyx Lv 1 2 pts. 8,594
  4. Avatar for rabamino12358 85. rabamino12358 Lv 1 2 pts. 8,589
  5. Avatar for Jesse Pinkman 86. Jesse Pinkman Lv 1 2 pts. 8,557
  6. Avatar for kludbrook 87. kludbrook Lv 1 2 pts. 8,533
  7. Avatar for pandapharmd 88. pandapharmd Lv 1 2 pts. 8,476
  8. Avatar for Deleted player 89. Deleted player pts. 8,472
  9. Avatar for Knoblerine 90. Knoblerine Lv 1 2 pts. 8,466

Comments