Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for HMT heritage 10. HMT heritage 6 pts. 9,520
  1. Avatar for Maerlyn138 21. Maerlyn138 Lv 1 1 pt. 10,731
  2. Avatar for Phyx 22. Phyx Lv 1 1 pt. 10,728
  3. Avatar for jausmh 23. jausmh Lv 1 1 pt. 10,708
  4. Avatar for Bruno Kestemont 24. Bruno Kestemont Lv 1 1 pt. 10,535
  5. Avatar for toshiue 25. toshiue Lv 1 1 pt. 10,329
  6. Avatar for Paulo Roque 26. Paulo Roque Lv 1 1 pt. 10,177
  7. Avatar for Vincera 27. Vincera Lv 1 1 pt. 9,964
  8. Avatar for Hellcat6 28. Hellcat6 Lv 1 1 pt. 9,683
  9. Avatar for fisherlr777 29. fisherlr777 Lv 1 1 pt. 9,681

Comments