Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 8,799
  2. Avatar for Trinity Biology 12. Trinity Biology 2 pts. 8,598
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,418
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,303
  6. Avatar for Czech National Team 17. Czech National Team 1 pt. 8,050
  7. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 7,959
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,704
  9. Avatar for AST Biology 20. AST Biology 1 pt. 7,544

  1. Avatar for jamiexq 41. jamiexq Lv 1 25 pts. 8,815
  2. Avatar for katling 42. katling Lv 1 24 pts. 8,814
  3. Avatar for silent gene 43. silent gene Lv 1 23 pts. 8,811
  4. Avatar for dbuske 44. dbuske Lv 1 22 pts. 8,802
  5. Avatar for robgee 45. robgee Lv 1 21 pts. 8,800
  6. Avatar for JasperD 46. JasperD Lv 1 20 pts. 8,799
  7. Avatar for drumpeter18yrs9yrs 47. drumpeter18yrs9yrs Lv 1 19 pts. 8,794
  8. Avatar for pvc78 48. pvc78 Lv 1 19 pts. 8,785
  9. Avatar for YeshuaLives 49. YeshuaLives Lv 1 18 pts. 8,779
  10. Avatar for Flagg65a 50. Flagg65a Lv 1 17 pts. 8,773

Comments