Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 8,799
  2. Avatar for Trinity Biology 12. Trinity Biology 2 pts. 8,598
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,418
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,303
  6. Avatar for Stuyvesant Molecular Science 2017-18 16. Stuyvesant Molecular Science 2017-18 1 pt. 8,074
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 8,050
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 7,959
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,704
  10. Avatar for AST Biology 20. AST Biology 1 pt. 7,544
  1. Avatar for rezaefar 51. rezaefar Lv 1 16 pts. 8,762
  2. Avatar for Vincera 52. Vincera Lv 1 16 pts. 8,761
  3. Avatar for guineapig 53. guineapig Lv 1 15 pts. 8,751
  4. Avatar for Norrjane 54. Norrjane Lv 1 14 pts. 8,740
  5. Avatar for dpmattingly 55. dpmattingly Lv 1 14 pts. 8,738
  6. Avatar for ViJay7019 56. ViJay7019 Lv 1 13 pts. 8,731
  7. Avatar for alwen 57. alwen Lv 1 12 pts. 8,727
  8. Avatar for dd-2 58. dd-2 Lv 1 12 pts. 8,719
  9. Avatar for aznarog 59. aznarog Lv 1 11 pts. 8,714
  10. Avatar for smilingone 60. smilingone Lv 1 11 pts. 8,711

Comments