Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 8,799
  2. Avatar for Trinity Biology 12. Trinity Biology 2 pts. 8,598
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,418
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,303
  6. Avatar for Stuyvesant Molecular Science 2017-18 16. Stuyvesant Molecular Science 2017-18 1 pt. 8,074
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 8,050
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 7,959
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,704
  10. Avatar for AST Biology 20. AST Biology 1 pt. 7,544
  1. Avatar for Reuben_Allen 71. Reuben_Allen Lv 1 6 pts. 8,627
  2. Avatar for zid 72. zid Lv 1 6 pts. 8,612
  3. Avatar for alyssa_d 73. alyssa_d Lv 1 6 pts. 8,598
  4. Avatar for andrewxc 74. andrewxc Lv 1 6 pts. 8,591
  5. Avatar for Altercomp 75. Altercomp Lv 1 5 pts. 8,570
  6. Avatar for Maerlyn138 76. Maerlyn138 Lv 1 5 pts. 8,559
  7. Avatar for WBarme1234 77. WBarme1234 Lv 1 5 pts. 8,554
  8. Avatar for Incongruous 78. Incongruous Lv 1 4 pts. 8,552
  9. Avatar for pfirth 79. pfirth Lv 1 4 pts. 8,544
  10. Avatar for katanyag 80. katanyag Lv 1 4 pts. 8,530

Comments