Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 3 pts. 8,799
  2. Avatar for Trinity Biology 12. Trinity Biology 2 pts. 8,598
  3. Avatar for freefolder 13. freefolder 1 pt. 8,570
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,418
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 8,303
  6. Avatar for Stuyvesant Molecular Science 2017-18 16. Stuyvesant Molecular Science 2017-18 1 pt. 8,074
  7. Avatar for Czech National Team 17. Czech National Team 1 pt. 8,050
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 7,959
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,704
  10. Avatar for AST Biology 20. AST Biology 1 pt. 7,544
  1. Avatar for Idiotboy 81. Idiotboy Lv 1 4 pts. 8,530
  2. Avatar for frostschutz 82. frostschutz Lv 1 4 pts. 8,507
  3. Avatar for ManVsYard 83. ManVsYard Lv 1 3 pts. 8,507
  4. Avatar for Hellcat6 84. Hellcat6 Lv 1 3 pts. 8,505
  5. Avatar for alcor29 85. alcor29 Lv 1 3 pts. 8,492
  6. Avatar for manu8170 86. manu8170 Lv 1 3 pts. 8,442
  7. Avatar for maxsteinbok 87. maxsteinbok Lv 1 3 pts. 8,437
  8. Avatar for rinze 88. rinze Lv 1 3 pts. 8,436
  9. Avatar for toshiue 89. toshiue Lv 1 2 pts. 8,434
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 2 pts. 8,425

Comments