Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,094
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,041
  3. Avatar for Contenders 3. Contenders 58 pts. 9,033
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 9,025
  5. Avatar for Go Science 5. Go Science 31 pts. 9,018
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 9,010
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,911
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,899
  10. Avatar for Russian team 10. Russian team 5 pts. 8,862
  1. Avatar for LociOiling 11. LociOiling Lv 1 13 pts. 9,023
  2. Avatar for toshiue 12. toshiue Lv 1 10 pts. 9,018
  3. Avatar for lamoille 13. lamoille Lv 1 7 pts. 9,018
  4. Avatar for gdnskye 14. gdnskye Lv 1 6 pts. 9,016
  5. Avatar for Hollinas 15. Hollinas Lv 1 4 pts. 9,015
  6. Avatar for actiasluna 16. actiasluna Lv 1 3 pts. 8,996
  7. Avatar for ManVsYard 17. ManVsYard Lv 1 2 pts. 8,992
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 2 pts. 8,975
  9. Avatar for silent gene 19. silent gene Lv 1 1 pt. 8,972
  10. Avatar for Maerlyn138 20. Maerlyn138 Lv 1 1 pt. 8,971

Comments