Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,094
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,041
  3. Avatar for Contenders 3. Contenders 58 pts. 9,033
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 9,025
  5. Avatar for Go Science 5. Go Science 31 pts. 9,018
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 9,010
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,911
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,899
  10. Avatar for Russian team 10. Russian team 5 pts. 8,862

  1. Avatar for blee2 121. blee2 Lv 1 1 pt. 8,021
  2. Avatar for morris3190 122. morris3190 Lv 1 1 pt. 8,006
  3. Avatar for syneal 123. syneal Lv 1 1 pt. 7,983
  4. Avatar for roman madala 124. roman madala Lv 1 1 pt. 7,980
  5. Avatar for Anamfija 125. Anamfija Lv 1 1 pt. 7,963
  6. Avatar for Ciccillo 126. Ciccillo Lv 1 1 pt. 7,959
  7. Avatar for martinf 127. martinf Lv 1 1 pt. 7,958
  8. Avatar for momadoc 128. momadoc Lv 1 1 pt. 7,945
  9. Avatar for goldfish80 129. goldfish80 Lv 1 1 pt. 7,927
  10. Avatar for sydlg19 130. sydlg19 Lv 1 1 pt. 7,908

Comments