Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,094
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,041
  3. Avatar for Contenders 3. Contenders 58 pts. 9,033
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 9,025
  5. Avatar for Go Science 5. Go Science 31 pts. 9,018
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 9,010
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,911
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,899
  10. Avatar for Russian team 10. Russian team 5 pts. 8,862

  1. Avatar for Bautho 101. Bautho Lv 1 1 pt. 8,351
  2. Avatar for Deleted player 102. Deleted player pts. 8,334
  3. Avatar for justjustin 103. justjustin Lv 1 1 pt. 8,327
  4. Avatar for boondog 104. boondog Lv 1 1 pt. 8,303
  5. Avatar for lvanonse 105. lvanonse Lv 1 1 pt. 8,303
  6. Avatar for micheldeweerd 106. micheldeweerd Lv 1 1 pt. 8,302
  7. Avatar for syoifczeri 107. syoifczeri Lv 1 1 pt. 8,301
  8. Avatar for Knoblerine 108. Knoblerine Lv 1 1 pt. 8,258
  9. Avatar for Squirrely 109. Squirrely Lv 1 1 pt. 8,256
  10. Avatar for Psych0Active 110. Psych0Active Lv 1 1 pt. 8,254

Comments