Placeholder image of a protein
Icon representing a puzzle

1601: Revisiting Puzzle 87: Zinc Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
November 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide is part of a larger protein that helps to regulate cell division, and is very important in early embryonic development. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

EKCSEHDERLKLYCKDDGTLSCVICRDSLKHASHNFLPI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,094
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,041
  3. Avatar for Contenders 3. Contenders 58 pts. 9,033
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 9,025
  5. Avatar for Go Science 5. Go Science 31 pts. 9,018
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 9,010
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 9,005
  8. Avatar for HMT heritage 8. HMT heritage 11 pts. 8,911
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 8,899
  10. Avatar for Russian team 10. Russian team 5 pts. 8,862
  1. Avatar for jausmh 31. jausmh Lv 1 36 pts. 8,873
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 35 pts. 8,866
  3. Avatar for Wojcimierz 33. Wojcimierz Lv 1 34 pts. 8,865
  4. Avatar for vakobo 34. vakobo Lv 1 33 pts. 8,862
  5. Avatar for gdnskye 35. gdnskye Lv 1 31 pts. 8,859
  6. Avatar for isaksson 36. isaksson Lv 1 30 pts. 8,839
  7. Avatar for jobo0502 37. jobo0502 Lv 1 29 pts. 8,837
  8. Avatar for NinjaGreg 38. NinjaGreg Lv 1 28 pts. 8,836
  9. Avatar for georg137 39. georg137 Lv 1 27 pts. 8,834
  10. Avatar for PlagueRat 40. PlagueRat Lv 1 26 pts. 8,825

Comments