Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,828
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 8,419
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 5,664
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 4,490
  5. Avatar for incognito group 15. incognito group 1 pt. 0
  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 10,380
  2. Avatar for Susume 2. Susume Lv 1 97 pts. 10,351
  3. Avatar for Mark- 3. Mark- Lv 1 93 pts. 10,257
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 90 pts. 10,231
  5. Avatar for grogar7 5. grogar7 Lv 1 87 pts. 10,228
  6. Avatar for LociOiling 6. LociOiling Lv 1 83 pts. 10,176
  7. Avatar for spvincent 7. spvincent Lv 1 80 pts. 10,174
  8. Avatar for reefyrob 8. reefyrob Lv 1 77 pts. 10,168
  9. Avatar for actiasluna 9. actiasluna Lv 1 74 pts. 10,142
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 71 pts. 10,125

Comments