Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for georg137 11. georg137 Lv 1 14 pts. 10,257
  2. Avatar for LociOiling 12. LociOiling Lv 1 11 pts. 10,236
  3. Avatar for micheldeweerd 13. micheldeweerd Lv 1 8 pts. 10,231
  4. Avatar for smilingone 14. smilingone Lv 1 6 pts. 10,225
  5. Avatar for lamoille 15. lamoille Lv 1 5 pts. 10,220
  6. Avatar for Hollinas 16. Hollinas Lv 1 4 pts. 10,207
  7. Avatar for Anfinsen_slept_here 17. Anfinsen_slept_here Lv 1 3 pts. 10,206
  8. Avatar for Hellcat6 18. Hellcat6 Lv 1 2 pts. 10,203
  9. Avatar for Amphimixus 19. Amphimixus Lv 1 2 pts. 10,196
  10. Avatar for Blipperman 20. Blipperman Lv 1 1 pt. 10,137

Comments