Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for retiredmichael 21. retiredmichael Lv 1 1 pt. 10,132
  2. Avatar for ManVsYard 22. ManVsYard Lv 1 1 pt. 10,089
  3. Avatar for jausmh 23. jausmh Lv 1 1 pt. 10,002
  4. Avatar for alwen 24. alwen Lv 1 1 pt. 9,996
  5. Avatar for mcatneuro1 25. mcatneuro1 Lv 1 1 pt. 9,971
  6. Avatar for nicobul 26. nicobul Lv 1 1 pt. 9,913
  7. Avatar for andrewxc 27. andrewxc Lv 1 1 pt. 9,901
  8. Avatar for actiasluna 28. actiasluna Lv 1 1 pt. 9,898
  9. Avatar for Maerlyn138 29. Maerlyn138 Lv 1 1 pt. 9,850
  10. Avatar for Primalsoul 30. Primalsoul Lv 1 1 pt. 9,650

Comments