1603: Unsolved De-novo Freestyle 138
Closed since over 7 years ago
Intermediate Overall PredictionSummary
- Created
- November 27, 2018
- Expires
- Max points
- 100
The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!
Sequence:
MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK
Top groups
-
100 pts. 10,408
-
-
-
-
-
-
-
-
-