Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 9,883
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167
  8. Avatar for BrownBiomolecular 18. BrownBiomolecular 1 pt. 0
  1. Avatar for rinze 91. rinze Lv 1 1 pt. 10,323
  2. Avatar for mitarcher 92. mitarcher Lv 1 1 pt. 10,311
  3. Avatar for mnucer 93. mnucer Lv 1 1 pt. 10,292
  4. Avatar for multaq 94. multaq Lv 1 1 pt. 10,256
  5. Avatar for oaks 95. oaks Lv 1 1 pt. 10,061
  6. Avatar for micheldeweerd 96. micheldeweerd Lv 1 1 pt. 10,046
  7. Avatar for Anfinsen_slept_here 97. Anfinsen_slept_here Lv 1 1 pt. 10,020
  8. Avatar for 01010011111 98. 01010011111 Lv 1 1 pt. 10,014
  9. Avatar for philipfoldit 99. philipfoldit Lv 1 1 pt. 10,012
  10. Avatar for Luka835 100. Luka835 Lv 1 1 pt. 9,982

Comments