Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 9,883
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167
  8. Avatar for BrownBiomolecular 18. BrownBiomolecular 1 pt. 0
  1. Avatar for memam2018 111. memam2018 Lv 1 1 pt. 9,797
  2. Avatar for famine 112. famine Lv 1 1 pt. 9,761
  3. Avatar for SiPot2018 113. SiPot2018 Lv 1 1 pt. 9,708
  4. Avatar for lamoille 114. lamoille Lv 1 1 pt. 9,694
  5. Avatar for SaBig2018 115. SaBig2018 Lv 1 1 pt. 9,655
  6. Avatar for momadoc 116. momadoc Lv 1 1 pt. 9,599
  7. Avatar for paulcianci 117. paulcianci Lv 1 1 pt. 9,578
  8. Avatar for Flagg65a 118. Flagg65a Lv 1 1 pt. 9,505
  9. Avatar for Alpar2018 119. Alpar2018 Lv 1 1 pt. 9,427
  10. Avatar for iniamp 120. iniamp Lv 1 1 pt. 9,246

Comments