Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 9,883
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167
  8. Avatar for BrownBiomolecular 18. BrownBiomolecular 1 pt. 0
  1. Avatar for Ciccillo 121. Ciccillo Lv 1 1 pt. 9,167
  2. Avatar for gmn 122. gmn Lv 1 1 pt. 9,141
  3. Avatar for tscherulli 123. tscherulli Lv 1 1 pt. 9,106
  4. Avatar for nathanbellot 124. nathanbellot Lv 1 1 pt. 8,978
  5. Avatar for BBode 125. BBode Lv 1 1 pt. 8,542
  6. Avatar for icaru-5 126. icaru-5 Lv 1 1 pt. 8,460
  7. Avatar for Victor Frankenstein 127. Victor Frankenstein Lv 1 1 pt. 6,821
  8. Avatar for rmoretti 128. rmoretti Lv 1 1 pt. 2,908
  9. Avatar for pauldunn 129. pauldunn Lv 1 1 pt. 0
  10. Avatar for MullaJBIO1300 130. MullaJBIO1300 Lv 1 1 pt. 0

Comments