Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 9,883
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167
  8. Avatar for BrownBiomolecular 18. BrownBiomolecular 1 pt. 0
  1. Avatar for jobo0502 11. jobo0502 Lv 1 68 pts. 11,205
  2. Avatar for grogar7 12. grogar7 Lv 1 65 pts. 11,201
  3. Avatar for Mark- 13. Mark- Lv 1 63 pts. 11,196
  4. Avatar for LociOiling 14. LociOiling Lv 1 60 pts. 11,192
  5. Avatar for smilingone 15. smilingone Lv 1 58 pts. 11,188
  6. Avatar for fpc 16. fpc Lv 1 55 pts. 11,185
  7. Avatar for phi16 17. phi16 Lv 1 53 pts. 11,168
  8. Avatar for frood66 18. frood66 Lv 1 51 pts. 11,166
  9. Avatar for vakobo 19. vakobo Lv 1 49 pts. 11,164
  10. Avatar for jausmh 20. jausmh Lv 1 47 pts. 11,158

Comments