Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167

  1. Avatar for Maerlyn138 41. Maerlyn138 Lv 1 17 pts. 10,996
  2. Avatar for manu8170 42. manu8170 Lv 1 16 pts. 10,987
  3. Avatar for guineapig 43. guineapig Lv 1 15 pts. 10,973
  4. Avatar for Galaxie 44. Galaxie Lv 1 15 pts. 10,952
  5. Avatar for cbwest 45. cbwest Lv 1 14 pts. 10,949
  6. Avatar for katling 46. katling Lv 1 13 pts. 10,949
  7. Avatar for Merf 47. Merf Lv 1 12 pts. 10,946
  8. Avatar for alcor29 48. alcor29 Lv 1 12 pts. 10,942
  9. Avatar for altejoh 49. altejoh Lv 1 11 pts. 10,930
  10. Avatar for jamiexq 50. jamiexq Lv 1 11 pts. 10,925

Comments