Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167

  1. Avatar for Znaika 61. Znaika Lv 1 5 pts. 10,848
  2. Avatar for RyeSnake 62. RyeSnake Lv 1 5 pts. 10,843
  3. Avatar for diamonddays 63. diamonddays Lv 1 5 pts. 10,837
  4. Avatar for Steven Pletsch 64. Steven Pletsch Lv 1 5 pts. 10,823
  5. Avatar for aznarog 65. aznarog Lv 1 4 pts. 10,820
  6. Avatar for isaksson 66. isaksson Lv 1 4 pts. 10,817
  7. Avatar for Glen B 67. Glen B Lv 1 4 pts. 10,798
  8. Avatar for silent gene 68. silent gene Lv 1 4 pts. 10,795
  9. Avatar for Lorxus 69. Lorxus Lv 1 3 pts. 10,781
  10. Avatar for orily1337 70. orily1337 Lv 1 3 pts. 10,759

Comments