Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,919
  2. Avatar for Czech National Team 12. Czech National Team 1 pt. 10,856
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 10,656
  4. Avatar for freefolder 14. freefolder 1 pt. 10,479
  5. Avatar for DW 2020 15. DW 2020 1 pt. 10,380
  6. Avatar for Team Schleswig-Holstein 16. Team Schleswig-Holstein 1 pt. 9,883
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 9,167
  8. Avatar for BrownBiomolecular 18. BrownBiomolecular 1 pt. 0
  1. Avatar for fisherlr777 81. fisherlr777 Lv 1 2 pts. 10,625
  2. Avatar for ManVsYard 82. ManVsYard Lv 1 1 pt. 10,608
  3. Avatar for heather-1 83. heather-1 Lv 1 1 pt. 10,590
  4. Avatar for Jesse Pinkman 84. Jesse Pinkman Lv 1 1 pt. 10,553
  5. Avatar for andrewxc 85. andrewxc Lv 1 1 pt. 10,500
  6. Avatar for benrh 86. benrh Lv 1 1 pt. 10,484
  7. Avatar for Altercomp 87. Altercomp Lv 1 1 pt. 10,479
  8. Avatar for DoctorSockrates 88. DoctorSockrates Lv 1 1 pt. 10,438
  9. Avatar for mikim2018 89. mikim2018 Lv 1 1 pt. 10,380
  10. Avatar for Deleted player 90. Deleted player pts. 10,327

Comments