Placeholder image of a protein
Icon representing a puzzle

1607: Revisiting Puzzle 89: Cow Eye

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 05, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Beta Folders 100 pts. 11,289
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 11,275
  3. Avatar for Contenders 3. Contenders 54 pts. 11,269
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 11,241
  5. Avatar for Go Science 5. Go Science 27 pts. 11,232
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 11,215
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 11,205
  8. Avatar for Russian team 8. Russian team 8 pts. 11,201
  9. Avatar for Gargleblasters 9. Gargleblasters 5 pts. 11,187
  10. Avatar for Marvin's bunch 10. Marvin's bunch 3 pts. 11,166

  1. Avatar for alwen 21. alwen Lv 1 1 pt. 10,894
  2. Avatar for Hellcat6 22. Hellcat6 Lv 1 1 pt. 10,658

Comments