Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 4 pts. 9,548
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,137
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,039
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,676
  5. Avatar for BCC 15. BCC 1 pt. 8,622
  6. Avatar for Czech National Team 16. Czech National Team 1 pt. 8,617
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,508
  8. Avatar for Eὕρηκα! Heureka! 18. Eὕρηκα! Heureka! 1 pt. 8,291
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,283
  10. Avatar for freefolder 20. freefolder 1 pt. 8,231
  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 9,813
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 9,778
  3. Avatar for frood66 3. frood66 Lv 1 94 pts. 9,765
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 91 pts. 9,754
  5. Avatar for actiasluna 5. actiasluna Lv 1 88 pts. 9,748
  6. Avatar for DoctorSockrates 6. DoctorSockrates Lv 1 86 pts. 9,747
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 83 pts. 9,743
  8. Avatar for Galaxie 8. Galaxie Lv 1 80 pts. 9,742
  9. Avatar for crpainter 9. crpainter Lv 1 77 pts. 9,717
  10. Avatar for O Seki To 10. O Seki To Lv 1 75 pts. 9,717

Comments