Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,831
  2. Avatar for phi16 2. phi16 Lv 1 81 pts. 9,818
  3. Avatar for robgee 3. robgee Lv 1 64 pts. 9,813
  4. Avatar for LociOiling 4. LociOiling Lv 1 50 pts. 9,788
  5. Avatar for Deleted player 5. Deleted player 39 pts. 9,785
  6. Avatar for reefyrob 6. reefyrob Lv 1 30 pts. 9,785
  7. Avatar for jausmh 7. jausmh Lv 1 23 pts. 9,783
  8. Avatar for smilingone 8. smilingone Lv 1 17 pts. 9,773
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 12 pts. 9,742
  10. Avatar for Phyx 10. Phyx Lv 1 9 pts. 9,737

Comments