Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for rezaefar 91. rezaefar Lv 1 2 pts. 8,825
  2. Avatar for dnpw1 92. dnpw1 Lv 1 2 pts. 8,819
  3. Avatar for Jesse Pinkman 93. Jesse Pinkman Lv 1 2 pts. 8,809
  4. Avatar for benrh 94. benrh Lv 1 2 pts. 8,788
  5. Avatar for RedEight 95. RedEight Lv 1 2 pts. 8,758
  6. Avatar for Steven Pletsch 96. Steven Pletsch Lv 1 1 pt. 8,742
  7. Avatar for dbuske 97. dbuske Lv 1 1 pt. 8,733
  8. Avatar for kludbrook 98. kludbrook Lv 1 1 pt. 8,717
  9. Avatar for navn 99. navn Lv 1 1 pt. 8,676
  10. Avatar for ehhan2018 100. ehhan2018 Lv 1 1 pt. 8,676

Comments