Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for Deleted player 111. Deleted player pts. 8,524
  2. Avatar for oureion 112. oureion Lv 1 1 pt. 8,508
  3. Avatar for SouperGenious 113. SouperGenious Lv 1 1 pt. 8,485
  4. Avatar for rinze 114. rinze Lv 1 1 pt. 8,482
  5. Avatar for Rastamasta 115. Rastamasta Lv 1 1 pt. 8,475
  6. Avatar for leannerikicheever 116. leannerikicheever Lv 1 1 pt. 8,473
  7. Avatar for sielenk 117. sielenk Lv 1 1 pt. 8,434
  8. Avatar for frostschutz 118. frostschutz Lv 1 1 pt. 8,433
  9. Avatar for TePie 119. TePie Lv 1 1 pt. 8,418
  10. Avatar for mirjamvandelft 120. mirjamvandelft Lv 1 1 pt. 8,413

Comments