Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for Altercomp 131. Altercomp Lv 1 1 pt. 8,231
  2. Avatar for multaq 132. multaq Lv 1 1 pt. 8,226
  3. Avatar for Grabl_Zinger 133. Grabl_Zinger Lv 1 1 pt. 8,220
  4. Avatar for Marvelz 134. Marvelz Lv 1 1 pt. 8,205
  5. Avatar for mikim2018 135. mikim2018 Lv 1 1 pt. 8,171
  6. Avatar for lamoille 136. lamoille Lv 1 1 pt. 8,118
  7. Avatar for IQuick143 137. IQuick143 Lv 1 1 pt. 8,090
  8. Avatar for ManVsYard 138. ManVsYard Lv 1 1 pt. 8,082
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 8,051
  10. Avatar for gardenpea 140. gardenpea Lv 1 1 pt. 8,050

Comments