Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945

  1. Avatar for hansvandenhof 141. hansvandenhof Lv 1 1 pt. 8,045
  2. Avatar for kyoota 142. kyoota Lv 1 1 pt. 8,043
  3. Avatar for Phil1911 143. Phil1911 Lv 1 1 pt. 8,041
  4. Avatar for raptorchief42 144. raptorchief42 Lv 1 1 pt. 7,963
  5. Avatar for bergie72 145. bergie72 Lv 1 1 pt. 7,901
  6. Avatar for Mortality 146. Mortality Lv 1 1 pt. 7,862
  7. Avatar for Psych0Active 147. Psych0Active Lv 1 1 pt. 7,862
  8. Avatar for Tomyk 148. Tomyk Lv 1 1 pt. 7,846
  9. Avatar for Deleted player 149. Deleted player pts. 7,801
  10. Avatar for dfmeow 150. dfmeow Lv 1 1 pt. 7,773

Comments