Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for jamiexq 151. jamiexq Lv 1 1 pt. 7,755
  2. Avatar for bob 152. bob Lv 1 1 pt. 7,557
  3. Avatar for aspadistra 153. aspadistra Lv 1 1 pt. 4,945
  4. Avatar for rm10487 154. rm10487 Lv 1 1 pt. 0
  5. Avatar for andrewxc 155. andrewxc Lv 1 1 pt. 0
  6. Avatar for Cappy96 156. Cappy96 Lv 1 1 pt. 0
  7. Avatar for Hollinas 157. Hollinas Lv 1 1 pt. 0
  8. Avatar for Ricardo Oliveira 158. Ricardo Oliveira Lv 1 1 pt. 0

Comments