Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for vakobo 51. vakobo Lv 1 15 pts. 9,369
  2. Avatar for joremen 52. joremen Lv 1 15 pts. 9,369
  3. Avatar for Phyx 53. Phyx Lv 1 14 pts. 9,368
  4. Avatar for manu8170 54. manu8170 Lv 1 13 pts. 9,354
  5. Avatar for grogar7 55. grogar7 Lv 1 13 pts. 9,354
  6. Avatar for silent gene 56. silent gene Lv 1 12 pts. 9,348
  7. Avatar for Maerlyn138 57. Maerlyn138 Lv 1 12 pts. 9,347
  8. Avatar for Norrjane 58. Norrjane Lv 1 11 pts. 9,344
  9. Avatar for Glen B 59. Glen B Lv 1 10 pts. 9,330
  10. Avatar for TastyMunchies 60. TastyMunchies Lv 1 10 pts. 9,325

Comments