Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for SETIKAH@KOREA 21. SETIKAH@KOREA 1 pt. 8,050
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 4,945
  1. Avatar for tarimo 61. tarimo Lv 1 10 pts. 9,323
  2. Avatar for alcor29 62. alcor29 Lv 1 9 pts. 9,322
  3. Avatar for alwen 63. alwen Lv 1 9 pts. 9,295
  4. Avatar for heather-1 64. heather-1 Lv 1 8 pts. 9,291
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 8 pts. 9,279
  6. Avatar for Flagg65a 66. Flagg65a Lv 1 7 pts. 9,233
  7. Avatar for cobaltteal 67. cobaltteal Lv 1 7 pts. 9,229
  8. Avatar for Vincera 68. Vincera Lv 1 7 pts. 9,176
  9. Avatar for ViJay7019 69. ViJay7019 Lv 1 6 pts. 9,153
  10. Avatar for Aminal88 70. Aminal88 Lv 1 6 pts. 9,137

Comments