1611: Revisiting Puzzle 90: Heliomicin
Closed since about 7 years ago
Novice Overall PredictionSummary
- Created
- December 19, 2018
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET