Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553
  1. Avatar for Altercomp 131. Altercomp Lv 1 1 pt. 8,231
  2. Avatar for multaq 132. multaq Lv 1 1 pt. 8,226
  3. Avatar for Grabl_Zinger 133. Grabl_Zinger Lv 1 1 pt. 8,220
  4. Avatar for Marvelz 134. Marvelz Lv 1 1 pt. 8,205
  5. Avatar for mikim2018 135. mikim2018 Lv 1 1 pt. 8,171
  6. Avatar for lamoille 136. lamoille Lv 1 1 pt. 8,118
  7. Avatar for IQuick143 137. IQuick143 Lv 1 1 pt. 8,090
  8. Avatar for ManVsYard 138. ManVsYard Lv 1 1 pt. 8,082
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 8,051
  10. Avatar for gardenpea 140. gardenpea Lv 1 1 pt. 8,050

Comments