Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553

  1. Avatar for vakobo 51. vakobo Lv 1 15 pts. 9,369
  2. Avatar for joremen 52. joremen Lv 1 15 pts. 9,369
  3. Avatar for Phyx 53. Phyx Lv 1 14 pts. 9,368
  4. Avatar for manu8170 54. manu8170 Lv 1 13 pts. 9,354
  5. Avatar for grogar7 55. grogar7 Lv 1 13 pts. 9,354
  6. Avatar for silent gene 56. silent gene Lv 1 12 pts. 9,348
  7. Avatar for Maerlyn138 57. Maerlyn138 Lv 1 12 pts. 9,347
  8. Avatar for Norrjane 58. Norrjane Lv 1 11 pts. 9,344
  9. Avatar for Glen B 59. Glen B Lv 1 10 pts. 9,330
  10. Avatar for TastyMunchies 60. TastyMunchies Lv 1 10 pts. 9,325

Comments