Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Overall Prediction

Summary


Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553

  1. Avatar for tarimo 61. tarimo Lv 1 10 pts. 9,323
  2. Avatar for alcor29 62. alcor29 Lv 1 9 pts. 9,322
  3. Avatar for alwen 63. alwen Lv 1 9 pts. 9,295
  4. Avatar for heather-1 64. heather-1 Lv 1 8 pts. 9,291
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 8 pts. 9,279
  6. Avatar for Flagg65a 66. Flagg65a Lv 1 7 pts. 9,233
  7. Avatar for cobaltteal 67. cobaltteal Lv 1 7 pts. 9,229
  8. Avatar for Vincera 68. Vincera Lv 1 7 pts. 9,176
  9. Avatar for ViJay7019 69. ViJay7019 Lv 1 6 pts. 9,153
  10. Avatar for Aminal88 70. Aminal88 Lv 1 6 pts. 9,137

Comments