Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553
  1. Avatar for vizhu2018 121. vizhu2018 Lv 1 1 pt. 8,396
  2. Avatar for jdmclure 122. jdmclure Lv 1 1 pt. 8,392
  3. Avatar for TheGUmmer 123. TheGUmmer Lv 1 1 pt. 8,374
  4. Avatar for micheldeweerd 124. micheldeweerd Lv 1 1 pt. 8,352
  5. Avatar for Savas 125. Savas Lv 1 1 pt. 8,291
  6. Avatar for mrfu 126. mrfu Lv 1 1 pt. 8,283
  7. Avatar for martinf 127. martinf Lv 1 1 pt. 8,279
  8. Avatar for tela 128. tela Lv 1 1 pt. 8,267
  9. Avatar for memam2018 129. memam2018 Lv 1 1 pt. 8,247
  10. Avatar for yavij2019 130. yavij2019 Lv 1 1 pt. 8,231

Comments