Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since over 7 years ago

Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction

Summary


Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553

  1. Avatar for Aubade01 11. Aubade01 Lv 1 72 pts. 9,705
  2. Avatar for Mark- 12. Mark- Lv 1 70 pts. 9,702
  3. Avatar for Timo van der Laan 13. Timo van der Laan Lv 1 68 pts. 9,700
  4. Avatar for nicobul 14. nicobul Lv 1 65 pts. 9,697
  5. Avatar for Heinermann 15. Heinermann Lv 1 63 pts. 9,680
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 61 pts. 9,676
  7. Avatar for johnmitch 17. johnmitch Lv 1 59 pts. 9,642
  8. Avatar for phi16 18. phi16 Lv 1 57 pts. 9,637
  9. Avatar for dcrwheeler 19. dcrwheeler Lv 1 55 pts. 9,634
  10. Avatar for YeshuaLives 20. YeshuaLives Lv 1 53 pts. 9,631

Comments