Placeholder image of a protein
Icon representing a puzzle

1611: Revisiting Puzzle 90: Heliomicin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
December 19, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,831
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,788
  3. Avatar for Marvin's bunch 3. Marvin's bunch 61 pts. 9,783
  4. Avatar for Gargleblasters 4. Gargleblasters 47 pts. 9,748
  5. Avatar for Go Science 5. Go Science 35 pts. 9,743
  6. Avatar for Contenders 6. Contenders 26 pts. 9,717
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,717
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,700
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,697
  10. Avatar for Russian team 10. Russian team 7 pts. 9,553
  1. Avatar for lconor 71. lconor Lv 1 6 pts. 9,105
  2. Avatar for toshiue 72. toshiue Lv 1 5 pts. 9,084
  3. Avatar for zid 73. zid Lv 1 5 pts. 9,068
  4. Avatar for KingLear 74. KingLear Lv 1 5 pts. 9,059
  5. Avatar for orily1337 75. orily1337 Lv 1 5 pts. 9,059
  6. Avatar for Merf 76. Merf Lv 1 4 pts. 9,047
  7. Avatar for Ikuso 77. Ikuso Lv 1 4 pts. 9,039
  8. Avatar for jausmh 78. jausmh Lv 1 4 pts. 9,022
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 4 pts. 8,984
  10. Avatar for sydlg19 80. sydlg19 Lv 1 4 pts. 8,984

Comments