Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 11,419
  2. Avatar for LociOiling 2. LociOiling Lv 1 81 pts. 11,411
  3. Avatar for LagMasterSam 3. LagMasterSam Lv 1 64 pts. 11,411
  4. Avatar for Galaxie 4. Galaxie Lv 1 50 pts. 11,305
  5. Avatar for robgee 5. robgee Lv 1 39 pts. 11,289
  6. Avatar for phi16 6. phi16 Lv 1 30 pts. 11,287
  7. Avatar for reefyrob 7. reefyrob Lv 1 23 pts. 11,259
  8. Avatar for alwen 8. alwen Lv 1 17 pts. 11,225
  9. Avatar for alcor29 9. alcor29 Lv 1 12 pts. 11,204
  10. Avatar for silent gene 10. silent gene Lv 1 9 pts. 11,142

Comments