Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,406
  2. Avatar for smilingone 2. smilingone Lv 1 97 pts. 11,345
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 11,294
  4. Avatar for jobo0502 4. jobo0502 Lv 1 91 pts. 11,278
  5. Avatar for matosfran 5. matosfran Lv 1 88 pts. 11,264
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 85 pts. 11,238
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 82 pts. 11,186
  8. Avatar for crpainter 8. crpainter Lv 1 80 pts. 11,173
  9. Avatar for Mark- 9. Mark- Lv 1 77 pts. 11,158
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 74 pts. 11,150

Comments