Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for reefyrob 21. reefyrob Lv 1 50 pts. 11,052
  2. Avatar for vakobo 22. vakobo Lv 1 48 pts. 11,045
  3. Avatar for Maerlyn138 23. Maerlyn138 Lv 1 47 pts. 11,033
  4. Avatar for frood66 24. frood66 Lv 1 45 pts. 11,022
  5. Avatar for spdenne 25. spdenne Lv 1 43 pts. 11,020
  6. Avatar for Heinermann 26. Heinermann Lv 1 41 pts. 11,013
  7. Avatar for spvincent 27. spvincent Lv 1 40 pts. 11,012
  8. Avatar for LagMasterSam 28. LagMasterSam Lv 1 38 pts. 10,996
  9. Avatar for Vinara 29. Vinara Lv 1 37 pts. 10,994
  10. Avatar for pvc78 30. pvc78 Lv 1 35 pts. 10,988

Comments