Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for alwen 41. alwen Lv 1 22 pts. 10,879
  2. Avatar for mbinfield 42. mbinfield Lv 1 22 pts. 10,878
  3. Avatar for MicElephant 43. MicElephant Lv 1 21 pts. 10,856
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 20 pts. 10,854
  5. Avatar for Glen B 45. Glen B Lv 1 19 pts. 10,847
  6. Avatar for Wojcimierz 46. Wojcimierz Lv 1 18 pts. 10,846
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 17 pts. 10,806
  8. Avatar for Mike Cassidy 48. Mike Cassidy Lv 1 16 pts. 10,799
  9. Avatar for silent gene 49. silent gene Lv 1 16 pts. 10,787
  10. Avatar for Argantyr 50. Argantyr Lv 1 15 pts. 10,757

Comments