Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 0
  5. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0
  1. Avatar for Znaika 71. Znaika Lv 1 5 pts. 10,140
  2. Avatar for benrh 72. benrh Lv 1 5 pts. 10,131
  3. Avatar for fpc 73. fpc Lv 1 5 pts. 10,113
  4. Avatar for Exonx 74. Exonx Lv 1 4 pts. 10,086
  5. Avatar for jamiexq 75. jamiexq Lv 1 4 pts. 10,073
  6. Avatar for aznarog 76. aznarog Lv 1 4 pts. 10,050
  7. Avatar for molleke 77. molleke Lv 1 4 pts. 10,049
  8. Avatar for jausmh 78. jausmh Lv 1 4 pts. 10,032
  9. Avatar for ViJay7019 79. ViJay7019 Lv 1 3 pts. 9,980
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 3 pts. 9,964

Comments