Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 10,485
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,049
  3. Avatar for FoldIt@Poland 13. FoldIt@Poland 1 pt. 9,557
  4. Avatar for Dutch Power Cows 15. Dutch Power Cows 1 pt. 0

  1. Avatar for georg137 81. georg137 Lv 1 3 pts. 9,937
  2. Avatar for Merf 82. Merf Lv 1 3 pts. 9,928
  3. Avatar for RyeSnake 83. RyeSnake Lv 1 3 pts. 9,918
  4. Avatar for RootBeerSwordsman 84. RootBeerSwordsman Lv 1 3 pts. 9,893
  5. Avatar for rabamino12358 85. rabamino12358 Lv 1 2 pts. 9,862
  6. Avatar for momadoc 86. momadoc Lv 1 2 pts. 9,855
  7. Avatar for fisherlr777 87. fisherlr777 Lv 1 2 pts. 9,833
  8. Avatar for cinnamonkitty 88. cinnamonkitty Lv 1 2 pts. 9,811
  9. Avatar for JasperD 89. JasperD Lv 1 2 pts. 9,810
  10. Avatar for Phyx 90. Phyx Lv 1 2 pts. 9,714

Comments