Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for KAOSkonfused 91. KAOSkonfused Lv 1 2 pts. 9,670
  2. Avatar for scottwuzhear 92. scottwuzhear Lv 1 2 pts. 9,662
  3. Avatar for leannerikicheever 93. leannerikicheever Lv 1 2 pts. 9,646
  4. Avatar for mitarcher 94. mitarcher Lv 1 1 pt. 9,630
  5. Avatar for Psych0Active 95. Psych0Active Lv 1 1 pt. 9,574
  6. Avatar for boondog 96. boondog Lv 1 1 pt. 9,563
  7. Avatar for oureion 97. oureion Lv 1 1 pt. 9,557
  8. Avatar for rinze 98. rinze Lv 1 1 pt. 9,553
  9. Avatar for borattt 99. borattt Lv 1 1 pt. 9,508
  10. Avatar for Deleted player 100. Deleted player pts. 9,488

Comments