Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for MrZanav 121. MrZanav Lv 1 1 pt. 8,059
  2. Avatar for Knoblerine 122. Knoblerine Lv 1 1 pt. 7,873
  3. Avatar for daggersmith3 123. daggersmith3 Lv 1 1 pt. 7,735
  4. Avatar for demonjacobs666 124. demonjacobs666 Lv 1 1 pt. 7,591
  5. Avatar for Mengee 125. Mengee Lv 1 1 pt. 7,309
  6. Avatar for kyoota 126. kyoota Lv 1 1 pt. 7,192
  7. Avatar for Sunmurder 127. Sunmurder Lv 1 1 pt. 7,118
  8. Avatar for fearjuan 128. fearjuan Lv 1 1 pt. 7,006
  9. Avatar for Zed3 129. Zed3 Lv 1 1 pt. 6,696
  10. Avatar for jung woo 130. jung woo Lv 1 1 pt. 6,655

Comments