Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for 01010011111 141. 01010011111 Lv 1 1 pt. 3,884
  2. Avatar for lconor 142. lconor Lv 1 1 pt. 3,643
  3. Avatar for anurankrgayen 143. anurankrgayen Lv 1 1 pt. 3,626
  4. Avatar for charleswei 144. charleswei Lv 1 1 pt. 3,546
  5. Avatar for Sjking221 145. Sjking221 Lv 1 1 pt. 0
  6. Avatar for dbuske 146. dbuske Lv 1 1 pt. 0
  7. Avatar for darioarena 147. darioarena Lv 1 1 pt. 0
  8. Avatar for mrfu 148. mrfu Lv 1 1 pt. 0
  9. Avatar for Grom 149. Grom Lv 1 1 pt. 0

Comments