Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for alwen 41. alwen Lv 1 22 pts. 10,879
  2. Avatar for mbinfield 42. mbinfield Lv 1 22 pts. 10,878
  3. Avatar for MicElephant 43. MicElephant Lv 1 21 pts. 10,856
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 20 pts. 10,854
  5. Avatar for Glen B 45. Glen B Lv 1 19 pts. 10,847
  6. Avatar for Wojcimierz 46. Wojcimierz Lv 1 18 pts. 10,846
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 17 pts. 10,806
  8. Avatar for Mike Cassidy 48. Mike Cassidy Lv 1 16 pts. 10,799
  9. Avatar for silent gene 49. silent gene Lv 1 16 pts. 10,787
  10. Avatar for Argantyr 50. Argantyr Lv 1 15 pts. 10,757

Comments