Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for TastyMunchies 61. TastyMunchies Lv 1 9 pts. 10,514
  2. Avatar for O Seki To 62. O Seki To Lv 1 8 pts. 10,485
  3. Avatar for Squirrely 63. Squirrely Lv 1 8 pts. 10,468
  4. Avatar for Sissue 64. Sissue Lv 1 8 pts. 10,461
  5. Avatar for tarimo 65. tarimo Lv 1 7 pts. 10,418
  6. Avatar for Aminal88 66. Aminal88 Lv 1 7 pts. 10,384
  7. Avatar for alcor29 67. alcor29 Lv 1 6 pts. 10,372
  8. Avatar for cbwest 68. cbwest Lv 1 6 pts. 10,346
  9. Avatar for micheldeweerd 69. micheldeweerd Lv 1 6 pts. 10,225
  10. Avatar for justjustin 70. justjustin Lv 1 5 pts. 10,167

Comments