Placeholder image of a protein
Icon representing a puzzle

1615b: Unsolved De-novo Freestyle 140

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
December 28, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PDEKDMEDKMRKVLKDLQDTTKDEELDRLMKELLKKMYEWLKKRKDKELFKKMLKLLKEVLDELKKDRDKRRLRELIDRMLKKIKKEVD

Top groups


  1. Avatar for Beta Folders 100 pts. 11,419
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,305
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 47 pts. 11,278
  4. Avatar for Contenders 4. Contenders 30 pts. 11,173
  5. Avatar for Go Science 5. Go Science 19 pts. 11,142
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 11,118
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 11,062
  8. Avatar for Russian team 8. Russian team 4 pts. 11,045
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 11,022
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 10,952

  1. Avatar for Znaika 71. Znaika Lv 1 5 pts. 10,140
  2. Avatar for benrh 72. benrh Lv 1 5 pts. 10,131
  3. Avatar for fpc 73. fpc Lv 1 5 pts. 10,113
  4. Avatar for Exonx 74. Exonx Lv 1 4 pts. 10,086
  5. Avatar for jamiexq 75. jamiexq Lv 1 4 pts. 10,073
  6. Avatar for aznarog 76. aznarog Lv 1 4 pts. 10,050
  7. Avatar for molleke 77. molleke Lv 1 4 pts. 10,049
  8. Avatar for jausmh 78. jausmh Lv 1 4 pts. 10,032
  9. Avatar for ViJay7019 79. ViJay7019 Lv 1 3 pts. 9,980
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 3 pts. 9,964

Comments